Class b: All beta proteins [48724] (126 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) |
Family b.42.2.1: Ricin B-like [50371] (2 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species European mistletoe (Viscum album) [TaxId:3972] [50375] (4 PDB entries) different sequence variants |
Domain d1m2tb1: 1m2t B:249-384 [84762] Other proteins in same PDB: d1m2ta_ |
PDB Entry: 1m2t (more details), 1.89 Å
SCOP Domain Sequences for d1m2tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)} avtctasepivrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirsn gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv qtldytlgqgwlagnd
Timeline for d1m2tb1: