Lineage for d1m2ma_ (1m2m A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333747Fold d.120: Cytochrome b5 [55855] (1 superfamily)
    small, heme-binding fold
  4. 333748Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 333749Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 333750Protein Cytochrome b5 [55858] (3 species)
  7. 333751Species Cow (Bos taurus) [TaxId:9913] [55859] (13 PDB entries)
  8. 333759Domain d1m2ma_: 1m2m A: [84755]
    complexed with hem; mutant

Details for d1m2ma_

PDB Entry: 1m2m (more details), 1.8 Å

PDB Description: crystal structure of e44a/e48a/e56a/d60a mutant of cytochrome b5

SCOP Domain Sequences for d1m2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ma_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus)}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlraqaggdatanfeavg
hstdarelsktfiigelhpddr

SCOP Domain Coordinates for d1m2ma_:

Click to download the PDB-style file with coordinates for d1m2ma_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ma_: