Lineage for d1m2ka_ (1m2k A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312760Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 312761Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 312841Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (3 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 312845Protein AF1676, Sir2 homolog (Sir2-AF1?) [63985] (1 species)
  7. 312846Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63986] (6 PDB entries)
  8. 312847Domain d1m2ka_: 1m2k A: [84754]
    complexed with apr, zn; mutant

Details for d1m2ka_

PDB Entry: 1m2k (more details), 1.47 Å

PDB Description: Sir2 homologue F159A mutant-ADP ribose complex

SCOP Domain Sequences for d1m2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus}
mdekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelanpqafakdpekv
wkwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlheragsrnvihlhgslr
vvrctscnnsfevesapkipplpkcdkcgsllrpgvvwagemlppdvldramreveradv
iivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgkagevmdelvrhv
rkalslkln

SCOP Domain Coordinates for d1m2ka_:

Click to download the PDB-style file with coordinates for d1m2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ka_: