Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein The Xlp protein Sap [55591] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries) |
Domain d1m27a_: 1m27 A: [84748] Other proteins in same PDB: d1m27c_ complex with Fyn SH3 domain and slam peptide, chain B complexed with flc |
PDB Entry: 1m27 (more details), 2.5 Å
SCOPe Domain Sequences for d1m27a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m27a_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
Timeline for d1m27a_: