Lineage for d1m1sa1 (1m1s A:100-206)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038156Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2038247Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 2038278Protein WR4 [89207] (1 species)
  7. 2038279Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89208] (1 PDB entry)
    4L504 (ZC168.6) gene product
  8. 2038280Domain d1m1sa1: 1m1s A:100-206 [84747]
    Other proteins in same PDB: d1m1sa2
    structural genomics

Details for d1m1sa1

PDB Entry: 1m1s (more details), 1.8 Å

PDB Description: structure of wr4, a c.elegans msp family member
PDB Compounds: (A:) wr4

SCOPe Domain Sequences for d1m1sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1sa1 b.1.11.2 (A:100-206) WR4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
minvdpptgnypatggnsthnitsesdsrlafkvkssnnehyrvrpvygfvdakgkskld
inrlpgppkedkiviqyaevpaeetdpmapfkagaqqgeiivkliaa

SCOPe Domain Coordinates for d1m1sa1:

Click to download the PDB-style file with coordinates for d1m1sa1.
(The format of our PDB-style files is described here.)

Timeline for d1m1sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m1sa2