SCOP 1.73: Domain d1m1sa_: 1m1s A:

Lineage for d1m1sa_ (1m1s A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein WR4 [89207] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89208] (1 PDB entry)
   4L504 (ZC168.6) gene product

8. Domain d1m1sa_: 1m1s A: [84747]
   structural genomics
   complexed with mse

Details for d1m1sa_

PDB Entry: 1m1s, 1.8 Å

PDB Description: structure of wr4, a c.elegans msp family member

PDB Compounds: (A:) wr4

SCOP Domain Sequences for d1m1sa_:

Sequence; same for both SEQRES and ATOM records:

>d1m1sa_ b.1.11.2 (A:) WR4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
hsminvdpptgnypatggnsthnitsesdsrlafkvkssnnehyrvrpvygfvdakgksk
ldinrlpgppkedkiviqyaevpaeetdpmapfkagaqqgeiivkliaa

Timeline for d1m1sa_:

• d1m1sa_ first appeared in SCOP 1.65
  
• d1m1sa_ appears in SCOP 1.71
  
• d1m1sa_ appears in SCOP 1.75
  
• d1m1sa_ appears in the current release, SCOPe 2.08, called d1m1sa1