Lineage for d1m1sa_ (1m1s A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551801Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 551848Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam 00635
  6. 551875Protein WR4 [89207] (1 species)
  7. 551876Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89208] (1 PDB entry)
    4L504 (ZC168.6) gene product
  8. 551877Domain d1m1sa_: 1m1s A: [84747]
    structural genomics
    complexed with mse

Details for d1m1sa_

PDB Entry: 1m1s (more details), 1.8 Å

PDB Description: structure of wr4, a c.elegans msp family member

SCOP Domain Sequences for d1m1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1sa_ b.1.11.2 (A:) WR4 {Nematode (Caenorhabditis elegans)}
hsminvdpptgnypatggnsthnitsesdsrlafkvkssnnehyrvrpvygfvdakgksk
ldinrlpgppkedkiviqyaevpaeetdpmapfkagaqqgeiivkliaa

SCOP Domain Coordinates for d1m1sa_:

Click to download the PDB-style file with coordinates for d1m1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1m1sa_: