SCOPe 2.02: Domain d1lzqb_: 1lzq B:

Lineage for d1lzqb_ (1lzq B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1lzqb_: 1lzq B: [84742]
   complexed with 0zq, bme; mutant

Details for d1lzqb_

PDB Entry: 1lzq, 2.2 Å

PDB Description: crystal structure of the complex of mutant hiv-1 protease (a71v, v82t, i84v) with an ethylenamine peptidomimetic inhibitor boc-phe- psi[ch2ch2nh]-phe-glu-phe-nh2

PDB Compounds: (B:) protease retropepsin

SCOPe Domain Sequences for d1lzqb_:

Sequence; same for both SEQRES and ATOM records:

>d1lzqb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf

Timeline for d1lzqb_:

• d1lzqb_ first appeared in SCOP 1.65
  
• d1lzqb_ appears in SCOPe 2.01
  
• d1lzqb_ appears in SCOPe 2.03
  
• d1lzqb_ appears in the current release, SCOPe 2.08