Lineage for d1lxnd_ (1lxn D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605185Superfamily d.58.48: MTH1187/YkoF-like [89957] (2 families) (S)
  5. 605186Family d.58.48.1: MTH1187-like [89958] (3 proteins)
    Pfam 01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 605187Protein Hypothetical protein MTH1187 [89959] (1 species)
  7. 605188Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [89960] (1 PDB entry)
  8. 605192Domain d1lxnd_: 1lxn D: [84740]
    structural genomics; NESG target TT272
    complexed with mse, so4

Details for d1lxnd_

PDB Entry: 1lxn (more details), 2.3 Å

PDB Description: x-ray structure of mth1187 northeast structural genomics consortium target tt272

SCOP Domain Sequences for d1lxnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxnd_ d.58.48.1 (D:) Hypothetical protein MTH1187 {Archaeon Methanobacterium thermoautotrophicum}
mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaa
heavlqagsdrvyttlkiddrrdadrglrdkvesvkeki

SCOP Domain Coordinates for d1lxnd_:

Click to download the PDB-style file with coordinates for d1lxnd_.
(The format of our PDB-style files is described here.)

Timeline for d1lxnd_: