Lineage for d1lxia_ (1lxi A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429052Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 429053Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 429102Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (7 proteins)
  6. 429117Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)
  7. 429118Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)
  8. 429119Domain d1lxia_: 1lxi A: [84735]
    complexed with nag

Details for d1lxia_

PDB Entry: 1lxi (more details), 2 Å

PDB Description: refinement of bmp7 crystal structure

SCOP Domain Sequences for d1lxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxia_ g.17.1.2 (A:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens)}
qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

SCOP Domain Coordinates for d1lxia_:

Click to download the PDB-style file with coordinates for d1lxia_.
(The format of our PDB-style files is described here.)

Timeline for d1lxia_: