Lineage for d1lxia_ (1lxi A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033727Protein Bone morphogenetic protein-7 (BMP-7) [57514] (1 species)
  7. 3033728Species Human (Homo sapiens) [TaxId:9606] [57515] (4 PDB entries)
  8. 3033729Domain d1lxia_: 1lxi A: [84735]
    complexed with nag

Details for d1lxia_

PDB Entry: 1lxi (more details), 2 Å

PDB Description: refinement of bmp7 crystal structure
PDB Compounds: (A:) bone morphogenetic protein 7

SCOPe Domain Sequences for d1lxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxia_ g.17.1.2 (A:) Bone morphogenetic protein-7 (BMP-7) {Human (Homo sapiens) [TaxId: 9606]}
qackkhelyvsfrdlgwqdwiiapegyaayycegecafplnsymnatnhaivqtlvhfin
petvpkpccaptqlnaisvlyfddssnvilkkyrnmvvracgch

SCOPe Domain Coordinates for d1lxia_:

Click to download the PDB-style file with coordinates for d1lxia_.
(The format of our PDB-style files is described here.)

Timeline for d1lxia_: