Class a: All alpha proteins [46456] (202 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) |
Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
Protein Excisionase Xis [89004] (1 species) |
Species Bacteriophage lambda [TaxId:10710] [89005] (2 PDB entries) |
Domain d1lx8a_: 1lx8 A: [84734] C-terminally truncated variant mutant |
PDB Entry: 1lx8 (more details)
SCOP Domain Sequences for d1lx8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lx8a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda} myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
Timeline for d1lx8a_: