![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) ![]() |
![]() | Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
![]() | Protein Excisionase Xis [89004] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [89005] (1 PDB entry) |
![]() | Domain d1lx8a_: 1lx8 A: [84734] truncated variant; lacks the C-terminal helix mutant |
PDB Entry: 1lx8 (more details)
SCOP Domain Sequences for d1lx8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lx8a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda} myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
Timeline for d1lx8a_: