Lineage for d1lx8a_ (1lx8 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278568Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 278569Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 278610Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 278611Protein Excisionase Xis [89004] (1 species)
  7. 278612Species Bacteriophage lambda [TaxId:10710] [89005] (1 PDB entry)
  8. 278613Domain d1lx8a_: 1lx8 A: [84734]
    truncated variant; lacks the C-terminal helix
    mutant

Details for d1lx8a_

PDB Entry: 1lx8 (more details)

PDB Description: regulation of directionality in bacteriophage lambda site-specific recombination: structure of the xis protein

SCOP Domain Sequences for d1lx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lx8a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp

SCOP Domain Coordinates for d1lx8a_:

Click to download the PDB-style file with coordinates for d1lx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1lx8a_: