Lineage for d1lx8a_ (1lx8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308672Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2308673Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2308770Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 2308771Protein Excisionase Xis [89004] (1 species)
  7. 2308772Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
    Uniprot P03699 1-55
  8. 2308781Domain d1lx8a_: 1lx8 A: [84734]
    C-terminally truncated variant

Details for d1lx8a_

PDB Entry: 1lx8 (more details)

PDB Description: Regulation of directionality in bacteriophage lambda site-specific recombination: structure of the Xis protein
PDB Compounds: (A:) Excisionase

SCOPe Domain Sequences for d1lx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lx8a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp

SCOPe Domain Coordinates for d1lx8a_:

Click to download the PDB-style file with coordinates for d1lx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1lx8a_: