Lineage for d1lvwd1 (1lvw D:1-292)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133274Protein RmlA (RfbA) [53465] (5 species)
  7. 2133305Species Methanobacterium thermoautotrophicum [TaxId:145262] [89759] (1 PDB entry)
  8. 2133309Domain d1lvwd1: 1lvw D:1-292 [84726]
    Other proteins in same PDB: d1lvwa2, d1lvwb2, d1lvwc2, d1lvwd2
    complexed with cl, gol, so4, tyd

Details for d1lvwd1

PDB Entry: 1lvw (more details), 1.7 Å

PDB Description: Crystal structure of glucose-1-phosphate thymidylyltransferase, RmlA, complex with dTDP
PDB Compounds: (D:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d1lvwd1:

Sequence, based on SEQRES records: (download)

>d1lvwd1 c.68.1.6 (D:1-292) RmlA (RfbA) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkgivlaggsgtrlypitravskqllpiydkpmiyyplsvlmlagirdiliistprdlpl
yrdllgdgsqfgvrfsyrvqeeprgiadafivgkdfigdskvalvlgdnvfyghrfseil
rraasledgavifgyyvrdprpfgvvefdsegrvisieekpsrpksnyvvpglyfydnqv
veiarriepsdrgeleitsvneeylrmgklrvelmgrgmawldtgthdglleassfieti
qkrqgfyiacleeiaynngwitredvlemaeklektdygkylrdlaegnfhg

Sequence, based on observed residues (ATOM records): (download)

>d1lvwd1 c.68.1.6 (D:1-292) RmlA (RfbA) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mkgivlaggtrlypitravskqllpiydkpmiyyplsvlmlagirdiliistprdlplyr
dllgdgsqfgvrfsyrvqeeprgiadafivgkdfigdskvalvlgdnvfyghrfseilrr
aasledgavifgyyvrdprpfgvvefdsegrvisieekpsrpksnyvvpglyfydnqvve
iarriepsdrgeleitsvneeylrmgklrvelmgrgmawldtgthdglleassfietiqk
rqgfyiacleeiaynngwitredvlemaeklektdygkylrdlaegnfhg

SCOPe Domain Coordinates for d1lvwd1:

Click to download the PDB-style file with coordinates for d1lvwd1.
(The format of our PDB-style files is described here.)

Timeline for d1lvwd1: