Lineage for d1lurb_ (1lur B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2044950Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 protein domains)
    automatically mapped to Pfam PF01263
  6. 2044951Protein Aldose 1-epimerase homologue [89277] (1 species)
  7. 2044952Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89278] (1 PDB entry)
    5C981 (C01B4.6 or YK2391) gene product
  8. 2044954Domain d1lurb_: 1lur B: [84718]
    structural genomics; NESG target WR66
    complexed with so4

Details for d1lurb_

PDB Entry: 1lur (more details), 1.85 Å

PDB Description: Crystal Structure of the GalM/aldose Epimerase Homologue from C. elegans, Northeast Structural Genomics Target WR66
PDB Compounds: (B:) aldose 1-epimerase

SCOPe Domain Sequences for d1lurb_:

Sequence, based on SEQRES records: (download)

>d1lurb_ b.30.5.4 (B:) Aldose 1-epimerase homologue {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
asgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefekdaasigktv
grvanriknstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhapesvsfsvrane
qddglpgdakidvtytvndrnqliiehhatcdtpgllaltnhaywnldgsdtvaehflem
eadefvevddtfcptgairsvtdtgfdfrsgkqlkesgkdaeelldldndlvitkktpps
tpstylrfwseksgielsittsypvihlyaskfldckgkkgehykankalaiepqfhsaa
pnfdhfpdvslrpgdhycqeivytfshvn

Sequence, based on observed residues (ATOM records): (download)

>d1lurb_ b.30.5.4 (B:) Aldose 1-epimerase homologue {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
asgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefekdaasigktv
grvanriknstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhapesvsfsvrane
qddglpgdakidvtytvndrnqliiehhatcdtpgllaltnhaywnldgsdtvaehflem
eadefvevddtfcptgairsvtdtgfdfrsgkqlkesgkdaeelldldndlvitkktpst
ylrfwseksgielsittsypvihlyaskfldckgkkgehykankalaiepqfhsaapnfd
hfpdvslrpgdhycqeivytfshvn

SCOPe Domain Coordinates for d1lurb_:

Click to download the PDB-style file with coordinates for d1lurb_.
(The format of our PDB-style files is described here.)

Timeline for d1lurb_: