Lineage for d1ltxr2 (1ltx R:445-557)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895243Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1895244Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1895633Family d.16.1.6: GDI-like [54399] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 1895642Protein Rab escort protein 1 [89845] (1 species)
  7. 1895643Species Norway rat (Rattus norvegicus) [TaxId:10116] [89846] (3 PDB entries)
    Uniprot P37727
  8. 1895649Domain d1ltxr2: 1ltx R:445-557 [84716]
    Other proteins in same PDB: d1ltxa1, d1ltxa2, d1ltxa3, d1ltxb_, d1ltxr1
    complexed with cl, far, zn

Details for d1ltxr2

PDB Entry: 1ltx (more details), 2.7 Å

PDB Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
PDB Compounds: (R:) Rab Escort Protein 1

SCOPe Domain Sequences for d1ltxr2:

Sequence, based on SEQRES records: (download)

>d1ltxr2 d.16.1.6 (R:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qyrqisravlitdgsvlktdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh
ltcmssktaredlervvqklftpyteieaeneqvekprllwalyfnmrdssdi

Sequence, based on observed residues (ATOM records): (download)

>d1ltxr2 d.16.1.6 (R:445-557) Rab escort protein 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qyrqisravlitdgsvlktdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvh
ltcmssktaredlervvqklftpyteieekprllwalyfnmrdssdi

SCOPe Domain Coordinates for d1ltxr2:

Click to download the PDB-style file with coordinates for d1ltxr2.
(The format of our PDB-style files is described here.)

Timeline for d1ltxr2: