Lineage for d1ltxb_ (1ltx B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542170Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 542171Species Rat (Rattus norvegicus) [TaxId:10116] [48250] (2 PDB entries)
  8. 542174Domain d1ltxb_: 1ltx B: [84714]
    Other proteins in same PDB: d1ltxa1, d1ltxa2, d1ltxa3, d1ltxr1, d1ltxr2
    complexed with cl, far, zn2; mutant

Details for d1ltxb_

PDB Entry: 1ltx (more details), 2.7 Å

PDB Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid

SCOP Domain Sequences for d1ltxb_:

Sequence, based on SEQRES records: (download)

>d1ltxb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus)}
kdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgqlhr
mnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqs
lqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrp
gseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwv
laslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeq
ikpvspvfcmpeevlqrvnvqpelvs

Sequence, based on observed residues (ATOM records): (download)

>d1ltxb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus)}
kdvtiksdpdtlllekhadyiasygscmseylrmsgvywgltvmdlmgqlhrmnkeeilv
fikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslqkedgsf
agdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgseshagq
iycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvlaslkiig
rlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqikpvspvf
cmpeevlqrvnvqpelvs

SCOP Domain Coordinates for d1ltxb_:

Click to download the PDB-style file with coordinates for d1ltxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ltxb_: