Lineage for d1ltxa2 (1ltx A:244-350)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529155Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529528Superfamily b.7.4: Rab geranylgeranyltransferase alpha-subunit, insert domain [49594] (1 family) (S)
    automatically mapped to Pfam PF07711
  5. 1529529Family b.7.4.1: Rab geranylgeranyltransferase alpha-subunit, insert domain [49595] (1 protein)
  6. 1529530Protein Rab geranylgeranyltransferase alpha-subunit, insert domain [49596] (1 species)
  7. 1529531Species Norway rat (Rattus norvegicus) [TaxId:10116] [49597] (2 PDB entries)
  8. 1529534Domain d1ltxa2: 1ltx A:244-350 [84712]
    Other proteins in same PDB: d1ltxa1, d1ltxa3, d1ltxb_, d1ltxr1, d1ltxr2
    complexed with cl, far, zn

Details for d1ltxa2

PDB Entry: 1ltx (more details), 2.7 Å

PDB Description: structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
PDB Compounds: (A:) rab geranylgeranyltransferase alpha subunit

SCOPe Domain Sequences for d1ltxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltxa2 b.7.4.1 (A:244-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vlccvhvsreeaclsvcfsrpltvgsrmgtlllmvdeaplsvewrtpdgrnrpshvwlcd
lpaaslndqlpqhtfrviwtgsdsqkecvllkdrpecwcrdsatdeq

SCOPe Domain Coordinates for d1ltxa2:

Click to download the PDB-style file with coordinates for d1ltxa2.
(The format of our PDB-style files is described here.)

Timeline for d1ltxa2: