Lineage for d1ltob_ (1lto B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 protein domains)
  6. 298847Protein Alpha tryptase I [89341] (1 species)
  7. 298848Species Human (Homo sapiens) [TaxId:9606] [89342] (1 PDB entry)
  8. 298850Domain d1ltob_: 1lto B: [84708]

Details for d1ltob_

PDB Entry: 1lto (more details), 2.2 Å

PDB Description: Human alpha1-tryptase

SCOP Domain Sequences for d1ltob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltob_ b.47.1.2 (B:) Alpha tryptase I {Human (Homo sapiens)}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahclgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswdegcaqpnrpgiytrvtyyldwihhy
vpk

SCOP Domain Coordinates for d1ltob_:

Click to download the PDB-style file with coordinates for d1ltob_.
(The format of our PDB-style files is described here.)

Timeline for d1ltob_: