Lineage for d1ltoa_ (1lto A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055982Protein Alpha tryptase I [89341] (1 species)
  7. 2055983Species Human (Homo sapiens) [TaxId:9606] [89342] (1 PDB entry)
  8. 2055984Domain d1ltoa_: 1lto A: [84707]

Details for d1ltoa_

PDB Entry: 1lto (more details), 2.2 Å

PDB Description: Human alpha1-tryptase
PDB Compounds: (A:) alpha tryptase I

SCOPe Domain Sequences for d1ltoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltoa_ b.47.1.2 (A:) Alpha tryptase I {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahclgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswdegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d1ltoa_:

Click to download the PDB-style file with coordinates for d1ltoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ltoa_: