Lineage for d1ltle_ (1ltl E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 375034Family b.40.4.11: DNA replication initiator (cdc21/cdc54) N-terminal domain [89332] (1 protein)
  6. 375035Protein DNA replication initiator (cdc21/cdc54) N-terminal domain [89333] (1 species)
    MCM complex protein; dodecamer assembly; includes the N-terminal all-alpha subdomain and inserted Zn-finger
  7. 375036Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [89334] (1 PDB entry)
  8. 375041Domain d1ltle_: 1ltl E: [84705]

Details for d1ltle_

PDB Entry: 1ltl (more details), 3 Å

PDB Description: the dodecamer structure of mcm from archaeal m. thermoautotrophicum

SCOP Domain Sequences for d1ltle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltle_ b.40.4.11 (E:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum}
mktvdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliek
pddviraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktde
irprivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklq
eplenlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnyte
fl

SCOP Domain Coordinates for d1ltle_:

Click to download the PDB-style file with coordinates for d1ltle_.
(The format of our PDB-style files is described here.)

Timeline for d1ltle_: