Lineage for d1ltla_ (1ltl A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297822Family b.40.4.11: DNA replication initiator (cdc21/cdc54) N-terminal domain [89332] (1 protein)
  6. 297823Protein DNA replication initiator (cdc21/cdc54) N-terminal domain [89333] (1 species)
    MCM complex protein; dodecamer assembly; includes the N-terminal all-alpha subdomain and inserted Zn-finger
  7. 297824Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [89334] (1 PDB entry)
  8. 297825Domain d1ltla_: 1ltl A: [84701]

Details for d1ltla_

PDB Entry: 1ltl (more details), 3 Å

PDB Description: the dodecamer structure of mcm from archaeal m. thermoautotrophicum

SCOP Domain Sequences for d1ltla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum}
vdksktltkfeeffslqdykdrvfeaiekypnvrsievdyldlemfdpdladlliekpdd
viraaqqairnidrlrknvdlnirfsgisnviplrelrskfigkfvavdgivrktdeirp
rivkavfecrgcmrhhavtqstnmitepslcsecggrsfrllqdesefldtqtlklqepl
enlsggeqprqitvvleddlvdtltpgdivrvtgtlrtvrdertkrfknfiygnytefl

SCOP Domain Coordinates for d1ltla_:

Click to download the PDB-style file with coordinates for d1ltla_.
(The format of our PDB-style files is described here.)

Timeline for d1ltla_: