Lineage for d1ltkb1 (1ltk B:2-415)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910394Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2910395Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2910396Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2910397Protein Phosphoglycerate kinase [53750] (9 species)
  7. 2910406Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [89783] (3 PDB entries)
  8. 2910413Domain d1ltkb1: 1ltk B:2-415 [84699]
    Other proteins in same PDB: d1ltka2, d1ltkb2, d1ltkc2
    complexed with amp, gol, so4

Details for d1ltkb1

PDB Entry: 1ltk (more details), 3 Å

PDB Description: crystal structure of phosphoglycerate kinase from plasmodium falciparum, in the open conformation
PDB Compounds: (B:) phosphoglycerate kinase

SCOPe Domain Sequences for d1ltkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltkb1 c.86.1.1 (B:2-415) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
lgnklsisdlkdiknkkvlvrvdfnvpiengiikdtnritatlptinhlkkegaskiili
shcgrpdglrnekytlkpvaetlkgllgeevlflndcvgkevedkinaakensvillenl
rfhieeegkgvdangnkvkankedvekfqndltkladvfindafgtahrahssmvgvkln
vkasgflmkkeleyfskalenpqrpllailggakvsdkiqliknlldkvdrmiigggmay
tfkkvlnnmkigtslfdeagskivgeimekakaknvqiflpvdfkiadnfdnnantkfvt
deegipdnwmgldagpksienykdviltsktviwngpqgvfempnfakgsieclnlvvev
tkkgaitivgggdtaslveqqnkkneishvstgggaslellegkelpgvlalsn

SCOPe Domain Coordinates for d1ltkb1:

Click to download the PDB-style file with coordinates for d1ltkb1.
(The format of our PDB-style files is described here.)

Timeline for d1ltkb1: