Lineage for d1ltka_ (1ltk A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592656Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 592657Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) (S)
  5. 592658Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein)
    Domain 2 binds ATP
  6. 592659Protein Phosphoglycerate kinase [53750] (7 species)
  7. 592666Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [89783] (1 PDB entry)
  8. 592667Domain d1ltka_: 1ltk A: [84698]

Details for d1ltka_

PDB Entry: 1ltk (more details), 3 Å

PDB Description: crystal structure of phosphoglycerate kinase from plasmodium falciparum, in the open conformation

SCOP Domain Sequences for d1ltka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum)}
hhhlgnklsisdlkdiknkkvlvrvdfnvpiengiikdtnritatlptinhlkkegaski
ilishcgrpdglrnekytlkpvaetlkgllgeevlflndcvgkevedkinaakensvill
enlrfhieeegkgvdangnkvkankedvekfqndltkladvfindafgtahrahssmvgv
klnvkasgflmkkeleyfskalenpqrpllailggakvsdkiqliknlldkvdrmiiggg
maytfkkvlnnmkigtslfdeagskivgeimekakaknvqiflpvdfkiadnfdnnantk
fvtdeegipdnwmgldagpksienykdviltsktviwngpqgvfempnfakgsieclnlv
vevtkkgaitivgggdtaslveqqnkkneishvstgggaslellegkelpgvlalsn

SCOP Domain Coordinates for d1ltka_:

Click to download the PDB-style file with coordinates for d1ltka_.
(The format of our PDB-style files is described here.)

Timeline for d1ltka_: