Lineage for d1lr8a2 (1lr8 A:89-136)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038463Protein Domain of follistatin [90166] (1 species)
    the C-terminal part of the heparin-binding module, FS1
  7. 3038464Species Norway rat (Rattus norvegicus) [TaxId:10116] [90167] (3 PDB entries)
  8. 3038466Domain d1lr8a2: 1lr8 A:89-136 [84682]
    Other proteins in same PDB: d1lr8a1
    complexed with ihs

Details for d1lr8a2

PDB Entry: 1lr8 (more details), 2.1 Å

PDB Description: crystal structure of fs1, the heparin-binding domain of follistatin, complexed with the heparin analogue d-myo-inositol hexasulphate (ins6s)
PDB Compounds: (A:) Follistatin

SCOPe Domain Sequences for d1lr8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lr8a2 g.68.1.1 (A:89-136) Domain of follistatin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
capdcsnitwkgpvcgldgktyrnecallkarckeqpelevqyqgkck

SCOPe Domain Coordinates for d1lr8a2:

Click to download the PDB-style file with coordinates for d1lr8a2.
(The format of our PDB-style files is described here.)

Timeline for d1lr8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lr8a1