SCOPe 2.08: Domain d1lqab_: 1lqa B:

Lineage for d1lqab_ (1lqa B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Tas protein [89461] (1 species)

7. Species Escherichia coli [TaxId:562] [89462] (1 PDB entry)

8. Domain d1lqab_: 1lqa B: [84675]
   structural genomics
   complexed with ndp

Details for d1lqab_

PDB Entry: 1lqa, 1.6 Å

PDB Description: tas protein from escherichia coli in complex with nadph

PDB Compounds: (B:) Tas protein

SCOPe Domain Sequences for d1lqab_:

Sequence; same for both SEQRES and ATOM records:

>d1lqab_ c.1.7.1 (B:) Tas protein {Escherichia coli [TaxId: 562]}
mqyhriphsslevstlglgtmtfgeqnseadahaqldyavaqginlidvaemypvpprpe
tqgltetyvgnwlakhgsrekliiaskvsgpsrnndkgirpdqaldrknirealhdslkr
lqtdyldlyqvhwpqrptncfgklgyswtdsapavslldtldalaeyqragkiryigvsn
etafgvmrylhladkhdlprivtiqnpysllnrsfevglaevsqyegvellaysclgfgt
ltgkylngakpagarntlfsrftrysgeqtqkavaayvdiarrhgldpaqmalafvrrqp
fvastllgattmdqlktnieslhlelsedvlaeieavhqvytypap

Timeline for d1lqab_:

• d1lqab_ first appeared in SCOP 1.65
  
• d1lqab_ appears in SCOPe 2.07