Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein Tas protein [89461] (1 species) |
Species Escherichia coli [TaxId:562] [89462] (1 PDB entry) |
Domain d1lqaa_: 1lqa A: [84674] structural genomics complexed with ndp |
PDB Entry: 1lqa (more details), 1.6 Å
SCOPe Domain Sequences for d1lqaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} mqyhriphsslevstlglgtmtfgeqnseadahaqldyavaqginlidvaemypvpprpe tqgltetyvgnwlakhgsrekliiaskvsgpsrnndkgirpdqaldrknirealhdslkr lqtdyldlyqvhwpqrptncfgklgyswtdsapavslldtldalaeyqragkiryigvsn etafgvmrylhladkhdlprivtiqnpysllnrsfevglaevsqyegvellaysclgfgt ltgkylngakpagarntlfsrftrysgeqtqkavaayvdiarrhgldpaqmalafvrrqp fvastllgattmdqlktnieslhlelsedvlaeieavhqvytypap
Timeline for d1lqaa_: