Class b: All beta proteins [48724] (126 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
Protein Coagulation factor Xa (Chrismas factor), protease domain [50574] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50575] (23 PDB entries) |
Domain d1lpgb_: 1lpg B: [84667] Other proteins in same PDB: d1lpga_ complexed with ca, ima |
PDB Entry: 1lpg (more details), 2 Å
SCOP Domain Sequences for d1lpgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpgb_ b.47.1.2 (B:) Coagulation factor Xa (Chrismas factor), protease domain {Human (Homo sapiens)} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d1lpgb_: