Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries) MTH649, smap1 |
Domain d1lojm1: 1loj M:11-80 [84662] Other proteins in same PDB: d1loja2, d1lojb2, d1lojc2, d1lojd2, d1loje2, d1lojf2, d1lojg2, d1lojh2, d1loji2, d1lojj2, d1lojk2, d1lojl2, d1lojm2, d1lojn2 complexed with mpd, u, uri |
PDB Entry: 1loj (more details), 1.9 Å
SCOPe Domain Sequences for d1lojm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lojm1 b.38.1.1 (M:11-80) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]} vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl irgdnivyis
Timeline for d1lojm1:
View in 3D Domains from other chains: (mouse over for more information) d1loja1, d1loja2, d1lojb1, d1lojb2, d1lojc1, d1lojc2, d1lojd1, d1lojd2, d1loje1, d1loje2, d1lojf1, d1lojf2, d1lojg1, d1lojg2, d1lojh1, d1lojh2, d1loji1, d1loji2, d1lojj1, d1lojj2, d1lojk1, d1lojk2, d1lojl1, d1lojl2, d1lojn1, d1lojn2 |