Lineage for d1lojj_ (1loj J:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296506Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 296507Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 296508Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 296509Protein Archaeal homoheptameric Sm protein [63758] (5 species)
  7. 296555Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 296586Domain d1lojj_: 1loj J: [84659]

Details for d1lojj_

PDB Entry: 1loj (more details), 1.9 Å

PDB Description: Crystal structure of a Methanobacterial Sm-like archaeal protein (SmAP1) bound to uridine-5'-monophosphate (UMP)

SCOP Domain Sequences for d1lojj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lojj_ b.38.1.1 (J:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyisrgklaa

SCOP Domain Coordinates for d1lojj_:

Click to download the PDB-style file with coordinates for d1lojj_.
(The format of our PDB-style files is described here.)

Timeline for d1lojj_: