Lineage for d1lo1a_ (1lo1 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2640382Protein Steroid hormone receptor Err2 DNA-binding domain [90201] (1 species)
  7. 2640383Species Human (Homo sapiens) [TaxId:9606] [90202] (1 PDB entry)
  8. 2640384Domain d1lo1a_: 1lo1 A: [84649]
    protein/DNA complex; complexed with zn

Details for d1lo1a_

PDB Entry: 1lo1 (more details)

PDB Description: estrogen related receptor 2 dna binding domain in complex with dna
PDB Compounds: (A:) Steroid hormone receptor ERR2

SCOPe Domain Sequences for d1lo1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
aipkrlclvcgdiasgyhygvasceackaffkrtiqgnieyscpatneceitkrrrkscq
acrfmkalkvgmlkegvrldrvrggrqkyk

SCOPe Domain Coordinates for d1lo1a_:

Click to download the PDB-style file with coordinates for d1lo1a_.
(The format of our PDB-style files is described here.)

Timeline for d1lo1a_: