Lineage for d1lnxd_ (1lnx D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312761Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1312762Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1312763Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1312764Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1312860Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 1312871Domain d1lnxd_: 1lnx D: [84645]
    complexed with acy, gol, uri

Details for d1lnxd_

PDB Entry: 1lnx (more details), 2.05 Å

PDB Description: Crystal structure of the P.aerophilum SmAP1 heptamer in a new crystal form (C2221)
PDB Compounds: (D:) small nuclear ribonucleoprotein homolog (Sm-like)

SCOPe Domain Sequences for d1lnxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnxd_ b.38.1.1 (D:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
cfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmv
vrgenvlfispvp

SCOPe Domain Coordinates for d1lnxd_:

Click to download the PDB-style file with coordinates for d1lnxd_.
(The format of our PDB-style files is described here.)

Timeline for d1lnxd_: