Lineage for d1lnla2 (1lnl A:305-405)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679446Fold b.112: C-terminal domain of mollusc hemocyanin [81278] (1 superfamily)
    six-stranded beta-sandwich, jelly-roll/greek-key topology
  4. 679447Superfamily b.112.1: C-terminal domain of mollusc hemocyanin [81277] (1 family) (S)
    analogous to the Ig-like domain of arthropod hemocyanin; similar sequential but different spatial position relative the shared domain
  5. 679448Family b.112.1.1: C-terminal domain of mollusc hemocyanin [81276] (1 protein)
  6. 679449Protein C-terminal domain of mollusc hemocyanin [69165] (2 species)
  7. 679453Species Mollusca (Rapana thomasiana) [TaxId:29165] [89218] (1 PDB entry)
  8. 679454Domain d1lnla2: 1lnl A:305-405 [84636]
    Other proteins in same PDB: d1lnla1, d1lnlb1, d1lnlc1

Details for d1lnla2

PDB Entry: 1lnl (more details), 3.3 Å

PDB Description: structure of deoxygenated hemocyanin from rapana thomasiana
PDB Compounds: (A:) Hemocyanin

SCOP Domain Sequences for d1lnla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnla2 b.112.1.1 (A:305-405) C-terminal domain of mollusc hemocyanin {Mollusca (Rapana thomasiana) [TaxId: 29165]}
adrvfagfllegigtsahldfsicaidgecthagyfdvlggsletpwqfdrlykyeitdv
leskgldvhdvfdikitqtswdnedistdrfpppsviyvpk

SCOP Domain Coordinates for d1lnla2:

Click to download the PDB-style file with coordinates for d1lnla2.
(The format of our PDB-style files is described here.)

Timeline for d1lnla2: