Lineage for d1lmeb_ (1lme B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily)
alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helixSuperfamily d.167.1: Peptide deformylase [56420] (2 families) 
nickel-dependent enzymeFamily d.167.1.1: Peptide deformylase [56421] (2 proteins)
automatically mapped to Pfam PF01327Protein Peptide deformylase [56422] (11 species) 
Species Thermotoga maritima [TaxId:2336] [90058] (1 PDB entry) 
Domain d1lmeb_: 1lme B: [84630]
Details for d1lmeb_
PDB Entry: 1lme (more details), 2.2 Å
PDB Description: Crystal Structure of Peptide Deformylase from Thermotoga maritima
PDB Compounds: (B:) Peptide deformylaseSCOPe Domain Sequences for d1lmeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmeb_ d.167.1.1 (B:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]}
hhmyrirvfgdpvlrkrakpvtkfdenlkktiermietmyhydgvglaapqvgisqrffv
mdvgngpvavinpeileidpetevaeegclsfpeifveierskrikvkyqntrgeyveee
legyaarvfqhefdhlngvliidrisp
SCOPe Domain Coordinates for d1lmeb_:
Click to download the PDB-style file with coordinates for d1lmeb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lmeb_:
- d1lmeb_ first appeared in SCOP 1.65
- d1lmeb_ appears in SCOPe 2.04
- d1lmeb_ is called d1lmeb1 in SCOPe 2.06
- d1lmeb_ appears in the current release, SCOPe 2.08, called d1lmeb1
View in 3D
