Lineage for d1lmea1 (1lme A:1-145)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234288Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2234289Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2234290Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2234291Protein Peptide deformylase [56422] (11 species)
  7. 2234403Species Thermotoga maritima [TaxId:2336] [90058] (1 PDB entry)
  8. 2234404Domain d1lmea1: 1lme A:1-145 [84629]
    Other proteins in same PDB: d1lmea2, d1lmeb2

Details for d1lmea1

PDB Entry: 1lme (more details), 2.2 Å

PDB Description: Crystal Structure of Peptide Deformylase from Thermotoga maritima
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1lmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmea1 d.167.1.1 (A:1-145) Peptide deformylase {Thermotoga maritima [TaxId: 2336]}
myrirvfgdpvlrkrakpvtkfdenlkktiermietmyhydgvglaapqvgisqrffvmd
vgngpvavinpeileidpetevaeegclsfpeifveierskrikvkyqntrgeyveeele
gyaarvfqhefdhlngvliidrisp

SCOPe Domain Coordinates for d1lmea1:

Click to download the PDB-style file with coordinates for d1lmea1.
(The format of our PDB-style files is described here.)

Timeline for d1lmea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lmea2