SCOPe 2.08: Domain d1lm4a1: 1lm4 A:1-183

Lineage for d1lm4a1 (1lm4 A:1-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Staphylococcus aureus [TaxId:1280] [75579] (9 PDB entries)
   Uniprot Q9F4L4

8. Domain d1lm4a1: 1lm4 A:1-183 [84626]
   Other proteins in same PDB: d1lm4a2, d1lm4b2
   complexed with fe, gol

Details for d1lm4a1

PDB Entry: 1lm4, 1.45 Å

PDB Description: Structure of Peptide Deformylase from Staphylococcus aureus at 1.45 A

PDB Compounds: (A:) peptide deformylase pdf1

SCOPe Domain Sequences for d1lm4a1:

Sequence; same for both SEQRES and ATOM records:

>d1lm4a1 d.167.1.1 (A:1-183) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev

Timeline for d1lm4a1:

• d1lm4a1 first appeared in SCOP 1.65, called d1lm4a_
  
• d1lm4a1 appears in SCOPe 2.07