Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (4 PDB entries) |
Domain d1lkja_: 1lkj A: [84623] |
PDB Entry: 1lkj (more details)
SCOPe Domain Sequences for d1lkja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae vddmlrevsdgsgeiniqqfaallsk
Timeline for d1lkja_: