Lineage for d1lkja_ (1lkj A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442704Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 442743Protein Calmodulin [47516] (10 species)
  7. 442755Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (3 PDB entries)
  8. 442757Domain d1lkja_: 1lkj A: [84623]

Details for d1lkja_

PDB Entry: 1lkj (more details)

PDB Description: nmr structure of apo calmodulin from yeast saccharomyces cerevisiae

SCOP Domain Sequences for d1lkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae)}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae
vddmlrevsdgsgeiniqqfaallsk

SCOP Domain Coordinates for d1lkja_:

Click to download the PDB-style file with coordinates for d1lkja_.
(The format of our PDB-style files is described here.)

Timeline for d1lkja_: