Lineage for d1ljya1 (1ljy A:1-239,A:308-362)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.5: Type II chitinase [51534] (15 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries) 
Domain d1ljya1: 1ljy A:1-239,A:308-362 [84618]
Other proteins in same PDB: d1ljya2
Details for d1ljya1
PDB Entry: 1ljy (more details), 2.9 Å
PDB Description: crystal structure of a novel regulatory 40 kda mammary gland protein (mgp-40) secreted during involution
PDB Compounds: (A:) mgp-40SCOPe Domain Sequences for d1ljya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljya1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev
SCOPe Domain Coordinates for d1ljya1:
Click to download the PDB-style file with coordinates for d1ljya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ljya1:
- d1ljya1 first appeared in SCOP 1.65
- d1ljya1 appears in SCOPe 2.07
View in 3D
