Lineage for d1lhza2 (1lhz A:113-214)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934961Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 934965Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 934980Domain d1lhza2: 1lhz A:113-214 [84613]
    Other proteins in same PDB: d1lhza1, d1lhzb1
    part of amyloidogenic protein BUR

Details for d1lhza2

PDB Entry: 1lhz (more details), 2.3 Å

PDB Description: structure of a human bence-jones dimer crystallized in u.s. space shuttle mission sts-95: 293k
PDB Compounds: (A:) immunoglobulin lambda light chain

SCOPe Domain Sequences for d1lhza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lhza2 b.1.1.2 (A:113-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d1lhza2:

Click to download the PDB-style file with coordinates for d1lhza2.
(The format of our PDB-style files is described here.)

Timeline for d1lhza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lhza1