Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (43 PDB entries) |
Domain d1lgvb2: 1lgv B:113-214 [84611] Other proteins in same PDB: d1lgva1, d1lgvb1 part of amyloidogenic protein BUR complexed with pca |
PDB Entry: 1lgv (more details), 1.95 Å
SCOP Domain Sequences for d1lgvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lgvb2 b.1.1.2 (B:113-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d1lgvb2: