Lineage for d1leib2 (1lei B:39-250)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772172Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1772406Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 1772410Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 1772414Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries)
  8. 1772420Domain d1leib2: 1lei B:39-250 [84602]
    Other proteins in same PDB: d1leia1, d1leia2, d1leib1
    protein/DNA complex

Details for d1leib2

PDB Entry: 1lei (more details), 2.7 Å

PDB Description: the kb dna sequence from the hlv-ltr functions as an allosteric regulator of hiv transcription
PDB Compounds: (B:) nuclear factor nf-kappa-b p50 subunit

SCOPe Domain Sequences for d1leib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leib2 b.2.5.3 (B:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOPe Domain Coordinates for d1leib2:

Click to download the PDB-style file with coordinates for d1leib2.
(The format of our PDB-style files is described here.)

Timeline for d1leib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1leib1