SCOP 1.67: Domain d1leia1: 1lei A:192-291

Lineage for d1leia1 (1lei A:192-291)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries)

8. Domain d1leia1: 1lei A:192-291 [84599]
   Other proteins in same PDB: d1leia2, d1leib1, d1leib2
   complexed with 5it

Details for d1leia1

PDB Entry: 1lei, 2.7 Å

PDB Description: the kb dna sequence from the hlv-ltr functions as an allosteric regulator of hiv transcription

SCOP Domain Sequences for d1leia1:

Sequence; same for both SEQRES and ATOM records:

>d1leia1 b.1.18.1 (A:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

Timeline for d1leia1:

• d1leia1 first appeared in SCOP 1.65
  
• d1leia1 appears in SCOP 1.69
  
• d1leia1 appears in the current release, SCOPe 2.08