Lineage for d1le9f2 (1le9 F:39-250)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378036Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 2378040Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries)
  8. 2378051Domain d1le9f2: 1le9 F:39-250 [84598]
    Other proteins in same PDB: d1le9a1, d1le9a2, d1le9a3, d1le9b1, d1le9e1, d1le9e2, d1le9e3, d1le9f1
    protein/DNA complex

Details for d1le9f2

PDB Entry: 1le9 (more details), 3 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to the ig/hiv-kb siti
PDB Compounds: (F:) nuclear factor nf-kappa-b p50 subunit

SCOPe Domain Sequences for d1le9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le9f2 b.2.5.3 (F:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOPe Domain Coordinates for d1le9f2:

Click to download the PDB-style file with coordinates for d1le9f2.
(The format of our PDB-style files is described here.)

Timeline for d1le9f2: