Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49425] (7 PDB entries) |
Domain d1le9f2: 1le9 F:39-250 [84598] Other proteins in same PDB: d1le9a1, d1le9a2, d1le9a3, d1le9b1, d1le9e1, d1le9e2, d1le9e3, d1le9f1 protein/DNA complex |
PDB Entry: 1le9 (more details), 3 Å
SCOPe Domain Sequences for d1le9f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1le9f2 b.2.5.3 (F:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl pdstgsftrrlepvvsdaiydskapnasnlki
Timeline for d1le9f2: