Lineage for d1le5e2 (1le5 E:20-191)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041213Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2041220Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)
  8. 2041230Domain d1le5e2: 1le5 E:20-191 [84588]
    Other proteins in same PDB: d1le5a1, d1le5a3, d1le5b1, d1le5b2, d1le5e1, d1le5e3, d1le5f1, d1le5f2
    protein/DNA complex

Details for d1le5e2

PDB Entry: 1le5 (more details), 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb
PDB Compounds: (E:) nuclear factor nf-kappa-b p65 subunit

SCOPe Domain Sequences for d1le5e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le5e2 b.2.5.3 (E:20-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnnn
pfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOPe Domain Coordinates for d1le5e2:

Click to download the PDB-style file with coordinates for d1le5e2.
(The format of our PDB-style files is described here.)

Timeline for d1le5e2: