Lineage for d1le5b1 (1le5 B:251-350)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765078Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 2765084Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)
  8. 2765102Domain d1le5b1: 1le5 B:251-350 [84585]
    Other proteins in same PDB: d1le5a1, d1le5a2, d1le5a3, d1le5b2, d1le5e1, d1le5e2, d1le5e3, d1le5f2
    protein/DNA complex

Details for d1le5b1

PDB Entry: 1le5 (more details), 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb
PDB Compounds: (B:) nuclear factor nf-kappa-b p50 subunit

SCOPe Domain Sequences for d1le5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le5b1 b.1.18.1 (B:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOPe Domain Coordinates for d1le5b1:

Click to download the PDB-style file with coordinates for d1le5b1.
(The format of our PDB-style files is described here.)

Timeline for d1le5b1: