| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
| Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries) |
| Domain d1le5b1: 1le5 B:251-350 [84585] Other proteins in same PDB: d1le5a1, d1le5a2, d1le5a3, d1le5b2, d1le5e1, d1le5e2, d1le5e3, d1le5f2 protein/DNA complex |
PDB Entry: 1le5 (more details), 2.75 Å
SCOPe Domain Sequences for d1le5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1le5b1 b.1.18.1 (B:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d1le5b1: