SCOP 1.65: Domain d1le5a1: 1le5 A:192-291

Lineage for d1le5a1 (1le5 A:192-291)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries)

8. Domain d1le5a1: 1le5 A:192-291 [84583]
   Other proteins in same PDB: d1le5a2, d1le5b1, d1le5b2, d1le5e2, d1le5f1, d1le5f2

Details for d1le5a1

PDB Entry: 1le5, 2.75 Å

PDB Description: crystal structure of a nf-kb heterodimer bound to an ifnb-kb

SCOP Domain Sequences for d1le5a1:

Sequence; same for both SEQRES and ATOM records:

>d1le5a1 b.1.18.1 (A:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

Timeline for d1le5a1:

• d1le5a1 is new in SCOP 1.65
  
• d1le5a1 appears in SCOP 1.67
  
• d1le5a1 appears in the current release, SCOPe 2.08