Lineage for d1ld3a_ (1ld3 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321573Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 321574Superfamily c.92.1: Chelatase [53800] (2 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 321575Family c.92.1.1: Ferrochelatase [53801] (1 protein)
  6. 321576Protein Ferrochelatase [53802] (3 species)
  7. 321577Species Bacillus subtilis [TaxId:1423] [53803] (6 PDB entries)
  8. 321583Domain d1ld3a_: 1ld3 A: [84582]
    complexed with zn

Details for d1ld3a_

PDB Entry: 1ld3 (more details), 2.6 Å

PDB Description: crystal structure of b. subilis ferrochelatase with zn(2+) bound at the active site.

SCOP Domain Sequences for d1ld3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld3a_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis}
srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
tvvlkklgr

SCOP Domain Coordinates for d1ld3a_:

Click to download the PDB-style file with coordinates for d1ld3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ld3a_: